SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016190 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016190
Domain Number 1 Region: 3-260
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.39e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0022
Further Details:      
 
Domain Number 2 Region: 301-412
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000022
Family FAD/NAD-linked reductases, N-terminal and central domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016190   Gene: ENSSSCG00000015267   Transcript: ENSSSCT00000016636
Sequence length 418
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:70088606:70126311:1 gene:ENSSSCG00000015267 transcript:ENSSSCT00000016636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKVAVIGAGVSGLISLKCCVDEGLEPTCFEQTEDIGGLWRFKENVEDGRASIYQSVIT
NTSKEMSCFSDFPMPEDFPNFLHNSKLLEYFRIFAQKFDLLKYIQFQTTVLSVKKRPDFS
SSGQWTVVTESNGKEQSAVFDAVMVCSGHHILPHIPLESFPGIQKFKGQYFHSRQYKHPE
GFERKRILVIGIGNSASDIAVELSKKAAQVFISTRHGSWVMGRISEDGYPWDMVFHTRFS
SMLRNVLPRTVVKWMMGQQMNRWFNHENYGLIPQNKYLMKEPILNDDLPSRILYGAIKVK
SKVKEITETSAIFEDGTVEEGIDVIVFATGYTFSFPFLEDPLVKVEDNMVLLYKYMFPPQ
LEKSTLACIGLIQPLGSIFPTVELQARWVTRVFKGLCTLPSERTMMADIISRNKRRID
Download sequence
Identical sequences ENSSSCP00000016190 ENSSSCP00000016190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]