SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016191 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016191
Domain Number 1 Region: 3-218
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.05e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0089
Further Details:      
 
Domain Number 2 Region: 159-331
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.34e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.017
Further Details:      
 
Domain Number 3 Region: 314-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000229
Family FAD/NAD-linked reductases, N-terminal and central domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016191   Gene: ENSSSCG00000015268   Transcript: ENSSSCT00000016637
Sequence length 532
Comment pep:known chromosome:Sscrofa10.2:9:70137792:70171698:1 gene:ENSSSCG00000015268 transcript:ENSSSCT00000016637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVS
NSCKEMSCYPDFPFPEDYPNYVPNSHFLEYLRMYANQFNLLKCIQFKTKVCSVTKHEDFN
TTGQWDVVTLCEGKQESAVFDAVMVCTGFLTNPYLPLDSFPGINTFKGQYFHSRQYKHPD
IFKDKSVLVVGMGNSGTDIAVEASHLAKKVFLSTTGGAWVISRVFDSGYPWDMVFMTRFQ
NMFRNSLPTPIVNWLIAKKMNSWFNHANYGLIPEDRIQLREPVLNDELPGRIITGKVLIK
PSIKEVKENSVVFNSSPEEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAH
LQKPTLAVIGLIKPLGSLLPTGDTQARWAVRVLKGVNKLPPSSVMIQEVNTRKENKPSGF
GLCYCKALQSDYIAYIDELLTYIDAKPNMFSLLLTDPHLALTIFFGPCTPYQFRLTGPGK
WEGARNAIMTQWDRTFKVTKTRIVKESPSPFASLLKLFSFLALLVAIFQIFL
Download sequence
Identical sequences P16549
9823.ENSSSCP00000016191 NP_999229.1.46622 XP_005656702.1.46622 ENSSSCP00000016191 ENSSSCP00000016191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]