SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016374 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016374
Domain Number 1 Region: 39-408
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.79e-61
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000013
Further Details:      
 
Domain Number 2 Region: 385-501
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.63e-44
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016374   Gene: ENSSSCG00000015443   Transcript: ENSSSCT00000016824
Sequence length 509
Comment pep:known chromosome:Sscrofa10.2:9:118410807:118437645:1 gene:ENSSSCG00000015443 transcript:ENSSSCT00000016824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSWSRVYCTLAKRGHFNRIAHGLQGVSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKA
AQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNL
EKMMEQKSNAVKALTGGIAHLFKQNKVVRVNGYGKITGKNQVTATKADGSTEVINTKNIL
IATGSEVTPFPGITIDEDTVVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGIGIDMEVSKNFQRILQKQGFKFKLNTKVIGATKKSDGNIDVSIEAASGGK
AEVITCDVLLVCIGRRPFTQNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGP
MLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGK
FPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHIIGPGAGEMINEAALALEYGASCEDI
ARVCHAHPTLSEAFREANLAASFGKAINF
Download sequence
Identical sequences F1SAF0
ENSSSCP00000016374 ENSSSCP00000016374 9823.ENSSSCP00000016374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]