SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016472 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016472
Domain Number 1 Region: 127-196
Classification Level Classification E-value
Superfamily Homeodomain-like 2.14e-20
Family Homeodomain 0.0015
Further Details:      
 
Domain Number 2 Region: 35-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000198
Family LIM domain 0.009
Further Details:      
 
Domain Number 3 Region: 4-34
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000221
Family LIM domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000016472
Domain Number - Region: 94-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0337
Family LIM domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016472   Gene: ENSSSCG00000015536   Transcript: ENSSSCT00000016925
Sequence length 369
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:133684612:133711973:1 gene:ENSSSCG00000015536 transcript:ENSSSCT00000016925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLSTEIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRCFSRAGSVYCKEDF
FKRFGTKCTACQQGIPPTQVVRKAQDFVYHLPCFACIICNRQLATGDEFYLMEDGRLVCK
EDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVV
QVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFRED
QILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGSPYGIPQSPSSISSLP
SHAPLLNGLDYTVDSNLGIVAHAGQGGSQTLRAMAGGPTSDISTGSSVGYPDFPTSPASW
LDEMDHPPF
Download sequence
Identical sequences ENSSSCP00000016472 ENSSSCP00000016472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]