SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016724 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016724
Domain Number 1 Region: 36-206
Classification Level Classification E-value
Superfamily Caspase-like 4.93e-61
Family Caspase catalytic domain 0.0000000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016724   Gene: ENSSSCG00000015783   Transcript: ENSSSCT00000017185
Sequence length 242
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:52291090:52300426:1 gene:ENSSSCG00000015783 transcript:ENSSSCT00000017185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANTKNSVDSKSIKTLETKILHGSKSVDSGISLDVSYKMDYPEMGLCIIINNKNFDKNTG
MACRSGTDVDAANLRETFTNLKYEVRNKNDLTREEILELMHSVSKEDHSKRSSFICVLLS
HGEEGKIFGTNGPVDLKKLTSFFRGDCCRTLTGKPKLFIIQACRGTELDCGIETDSGTED
DMACQKIPVEADFLYAYSTAPGKKLTNTKCYAQILNNEQSIPKAVKILISIRNSHLLNFR
VP
Download sequence
Identical sequences ENSSSCP00000016724 ENSSSCP00000016724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]