SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016738 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016738
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily PDZ domain-like 5.78e-23
Family PDZ domain 0.0000175
Further Details:      
 
Domain Number 2 Region: 320-349
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000138
Family LIM domain 0.00075
Further Details:      
 
Domain Number 3 Region: 288-319
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000131
Family LIM domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016738   Gene: ENSSSCG00000015796   Transcript: ENSSSCT00000017199
Sequence length 365
Comment pep:known chromosome:Sscrofa10.2:15:53297822:53328139:-1 gene:ENSSSCG00000015796 transcript:ENSSSCT00000017199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQNVILPGPAPWGFRLSGGIDFNQPLIITRITPGSKAAAANLCPGDVILAIDGYGTESM
THADAQDRIKAAAHQLCLKIDRAETRLWSPQVTEDGKAHPFKINLESEPQDVNYFEHKHN
IRPKPFIIPGRSSGCSTPSGIDGGSGRSTPSSVSTLSTICPGDLKVAAKMAPNIPLEMEL
PGVKIVHAQFNTPMQLYSDDNIMETLQGQVSTALGETPSMSEPTTASVPPQSDVYRMLHD
NRNEPTQPRQSGSFRVLQELVNDGPDDRPAGTRSVRAPVTKIHGGAGGTQKMPLCDKCGS
GIVGAVVKARDKYRHPECFVCADCNLNLKQKGYFFVEGELYCETHARARMRPPEGYDTVT
LYPKA
Download sequence
Identical sequences D3GGC5 Q6QGC0
ENSSSCP00000016738 NP_001001637.1.46622 ENSSSCP00000016738 9823.ENSSSCP00000016738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]