SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016776 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016776
Domain Number 1 Region: 665-743
Classification Level Classification E-value
Superfamily DEATH domain 2.99e-19
Family DEATH domain, DD 0.0000628
Further Details:      
 
Domain Number 2 Region: 59-112
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000288
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 3 Region: 118-165
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000105
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 4 Region: 1-61
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000117
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016776   Gene: ENSSSCG00000015830   Transcript: ENSSSCT00000017238
Sequence length 755
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:57373096:57561665:-1 gene:ENSSSCG00000015830 transcript:ENSSSCT00000017238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVY
VNGGWSSWTEWSACNVRCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCTSLCPEVDG
SWEVWSEWSVCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCILDKKPLHEI
KPQSIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSQSDYGVDVIDSSALTGGFQTFNF
KTVRQGNSLLLNPSMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNPLSDIKVKVQSSF
VVSLGVSERAEYHGKNHSGTFPHGNNHSFTTVHPRNKTPYIQNLSSLPTRTELRTTGVFG
HLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSTTLQSDGSEVLLSPEVTCGP
PDMIVTTPFALTIPHCADVSSEHWNIHLKKRTQQGKWEEVMSVEDESTSCYCLLDPFACH
VLLDSFGTYALTGEPITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVVSDE
RHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPSSVEWKEKRRGRYEEVPFSRVWCSNRQP
LHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQVQTSILESERETITFFAQEDSTYPAQ
TGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLW
EARHQHDGDLDSLACALEEIGRTHTKLSNMTESQL
Download sequence
Identical sequences ENSSSCP00000016776 ENSSSCP00000016776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]