SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016790 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016790
Domain Number 1 Region: 32-370
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.89e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000456
Further Details:      
 
Domain Number 2 Region: 379-492
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.26e-36
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016790   Gene: ENSSSCG00000015844   Transcript: ENSSSCT00000017252
Sequence length 493
Comment pep:known chromosome:Sscrofa10.2:15:61755136:61806030:1 gene:ENSSSCG00000015844 transcript:ENSSSCT00000017252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPPTRPASVFPRAMASRQESQPQCWPPARSVATSFDYLVIGGGSGGLASARRAAELGAR
AAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHVDYGFQSCESKFNWRVIKEKRDA
YVSRLNTIYQNNLTKSHIEIIHGHAAFTSDPQPTVEVNGKKYTAPHILIATGGVPSVPPE
SQIPGASLGITSDGFFQLEELPSRSVIVGAGYIAVEIAGILSALGSKTSLMIRHDKVLRS
FDSIISSNCTEELENAGIEVLKYSQVKEVKKTSSGLELCMVTSVPGRKPTFSTISGVDCL
LWAIGRDPNSRGLNLSQLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVCGRALLTPVAIAA
GRKLAHRLFECKEDSKLDYDNIPTVVFSHPPIGTVGLTEDEAICKYGKENVKIYSTTFTP
MYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGIGCDEMLQGFAVAVKMGATKSDFDNTVA
IHPTSSEELVTLR
Download sequence
Identical sequences ENSSSCP00000016790 ENSSSCP00000016790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]