SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016821 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016821
Domain Number 1 Region: 54-184,215-328
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.18e-41
Family FAD/NAD-linked reductases, N-terminal and central domains 0.057
Further Details:      
 
Domain Number 2 Region: 621-695
Classification Level Classification E-value
Superfamily EF-hand 2.68e-17
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number 3 Region: 313-407
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000961
Family D-aminoacid oxidase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016821   Gene: ENSSSCG00000015872   Transcript: ENSSSCT00000017283
Sequence length 729
Comment pep:known chromosome:Sscrofa10.2:15:70811286:70946574:1 gene:ENSSSCG00000015872 transcript:ENSSSCT00000017283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQKAVKGTVLVGGGALATILGLSQFAHYKRKQVNLAFVEAADCVSEPVNREPPSREAQ
ILTLKNTTEFDVLVIGGGATGSGCALDAVTRGYTGLKTALVERDDFSSGTSSRSTKLIHG
GVRYLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPIYKWWQLPYYWVGI
KLYDLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAA
RYGAATANYMEVVSLLKKTDPQTGKERVSGARCKDVLTGQEFDVRAKCVINATGPFTDTV
RRMDDKDATAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDT
PTDVTNHPIPSEEDINFILNEVRNYLSSDVEVRRGDVLAAWSGIRPLVTDPKSADTQSIS
RNHVVDISESGLITIAGGKWTTYRSMAEDTINAAVKAHNLNAGPSRTVGLFLQGGKDWSP
TLYIRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKWPIVGVRLVSEFPYIEAEVK
YGIKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWNDSKKEEELETARKF
LYYEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESINVQ
MDENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPI
PVDRSCGGF
Download sequence
Identical sequences ENSSSCP00000016821 ENSSSCP00000016821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]