SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016917 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016917
Domain Number 1 Region: 147-228
Classification Level Classification E-value
Superfamily TGS-like 2.4e-36
Family G domain-linked domain 0.0000562
Further Details:      
 
Domain Number 2 Region: 6-169
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-20
Family G proteins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016917   Gene: ENSSSCG00000015963   Transcript: ENSSSCT00000017382
Sequence length 238
Comment pep:known chromosome:Sscrofa10.2:15:89391937:89461981:-1 gene:ENSSSCG00000015963 transcript:ENSSSCT00000017382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHL
FLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEE
RQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDF
EKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK
Download sequence
Identical sequences A0A2I2YU06 A0A2J8PR15 F7GR54
ENSP00000340167 ENSCJAP00000044506 NP_001011708.1.87134 NP_001011708.1.92137 XP_003824290.1.60992 XP_003949968.1.37143 XP_004409048.1.74151 XP_004577109.1.84141 XP_006213992.1.17985 XP_006744649.1.47382 XP_011283607.1.62641 XP_011355676.1.92234 XP_011799364.1.43180 XP_015452273.1.64745 XP_018878029.1.27298 ENSP00000340167 ENSSSCP00000016917 gi|58761502|ref|NP_001011708.1| ENSPANP00000018192 ENSSSCP00000016917 ENSMMUP00000038122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]