SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017059 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017059
Domain Number 1 Region: 240-484
Classification Level Classification E-value
Superfamily Caspase-like 5.68e-57
Family Caspase catalytic domain 0.00018
Further Details:      
 
Domain Number 2 Region: 95-188
Classification Level Classification E-value
Superfamily DEATH domain 5.06e-24
Family DEATH effector domain, DED 0.0094
Further Details:      
 
Domain Number 3 Region: 10-79
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000113
Family DEATH effector domain, DED 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017059   Gene: ENSSSCG00000016101   Transcript: ENSSSCT00000017531
Sequence length 487
Comment pep:known chromosome:Sscrofa10.2:15:116106029:116184792:1 gene:ENSSSCG00000016101 transcript:ENSSSCT00000017531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLYRMSAEVIHQVEEALDEDEKEILLFLCRDIAADVVPLNVRDLLDILRERGKLSLVSL
AELLYRVRRFDLLKRILKMDRRTVEAQLLRHPHLISDYRVLMMEIGEGLDKSDVSSLIFL
MRDHISRSKMAKDKSFLDLVIELEKLNLVAPDHLDLLEKCLRNIHRIDLKTKIQKYKQSA
QGAETNYVNALQASLPNLSIKDPSYNLRLQNGRSKEQSLILGHPDFQRDPVKTSIQESGA
FLLQHVPEERYKMQSKPLGICLIIDCVGNDTDVLRDTFSSLGYEVQYFLYLKVEQISKIL
RKVARMPQHQDYDSFVCVLVSRGGSQSVFGVDKTLSGFPLDHIRRMFMADVCPTLLGKPK
LFFIQIYVTSEGQLEDSSFLEVDGPSVKSMDSKARQPGTCTVHREADFFWSLCKADVSLL
ERPSSSSSVYLQCLSQKLGKERKVSLLELHVDLNSKVYDWNSRVSAKERYYVRLQHTLRK
KVILSCK
Download sequence
Identical sequences Q6QN97
NP_001001628.1.46622 ENSSSCP00000017059 ENSSSCP00000017059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]