SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017064 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017064
Domain Number 1 Region: 234-486
Classification Level Classification E-value
Superfamily Caspase-like 2.24e-73
Family Caspase catalytic domain 0.0000000141
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily DEATH domain 1.41e-31
Family DEATH effector domain, DED 0.0046
Further Details:      
 
Domain Number 3 Region: 98-152
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000883
Family DEATH effector domain, DED 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017064   Gene: ENSSSCG00000016106   Transcript: ENSSSCT00000017536
Sequence length 488
Comment pep:known chromosome:Sscrofa10.2:15:116230364:116266946:-1 gene:ENSSSCG00000016106 transcript:ENSSSCT00000017536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFNRCLYNIGEHLDSDDLASLKFLSLDYIPHRKQEPIKDALMLFQRLQEKRMLEESNLS
FLKELLFRMNRLDLLINYLETNEEEMESELRIPGRAQISAYRVMLFQISENVTRSELKDF
KFFLSQEIAKCKLDDDMMSCLHLYLLLCSRLISGERCNLYTFERICTRYKKHLSDKSCSG
ERVNQHRWLQKKSASREDSHPMRMLVIQYISWCSIRKSPCCSLKNSFCPSSRSFYVLKSN
VNGKCKVFNKHLWAKGRLNLQRLENLHSFWIKRGDGSALSKTFSDLHFEVRPYKDVTAKG
ICDVLEYYRNLDHNDKDCFVCCILSHGDKGIIYGSDGREAPIYDLTSYFTGSKCPSLLGK
PKIFFIQACQGDKYQKGIAIETDSEQTEAYLEMDSSLQKRYIPDEADFLLGMATVNNCVS
YRSTMEGTWYIQSLCQSLKERCPRGEDILTILTKVNFEVSNKDDKKNMGKQMPQPTFTLR
KKLFFPLN
Download sequence
Identical sequences ENSSSCP00000017064 ENSSSCP00000017064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]