SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017318 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017318
Domain Number 1 Region: 61-133
Classification Level Classification E-value
Superfamily Ribosomal protein S18 1.1e-21
Family Ribosomal protein S18 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017318   Gene: ENSSSCG00000016344   Transcript: ENSSSCT00000017799
Sequence length 196
Comment pep:novel chromosome:Sscrofa10.2:15:153225973:153241316:1 gene:ENSSSCG00000016344 transcript:ENSSSCT00000017799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGLNVLVSGCGRLLRGLLAGPAATSWARPPSRGFREVVQILDGKTTIIEGRITETPQES
PNPPNPTGQCPICRWNLKHKYNYEDVLLLSQFIRPHGGMLPRRITGLCQEEHLKIEECVK
MAHRAGLLPNHRPKLPEGFVPKSKPRLNRYLTRWSPRSVKPIYNKGHRWNKVRMPVGSPL
LKDNVSYSGRPLLLYH
Download sequence
Identical sequences ENSSSCP00000017318 9823.ENSSSCP00000017318 ENSSSCP00000017318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]