SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017322 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017322
Domain Number 1 Region: 147-399
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.26e-28
Family G proteins 0.002
Further Details:      
 
Domain Number 2 Region: 475-563
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 8.22e-16
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0033
Further Details:      
 
Domain Number 3 Region: 385-471
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000728
Family Elongation factors 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017322   Gene: ENSSSCG00000016348   Transcript: ENSSSCT00000017803
Sequence length 577
Comment pep:known chromosome:Sscrofa10.2:15:153136233:153145500:1 gene:ENSSSCG00000016348 transcript:ENSSSCT00000017803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRGGGGGGGGGGGGGEKENPRGRSSKEKISPQLSPEAEDGNIEYKLKLVNPSQYRFEHLV
TQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITVLREREV
DYDSDTPRKITEVLVRKVPDNQQFLDLRVAVLGNVDSGKSTLLGVLTQGELDNGRGRARL
NLFRHLHEIQSGRTSSISFEILGFNSKGEVVNYSDSRTAEEICESSSKMITFIDLAGHHK
YLHTTIFGLTSYCPDCALLLVSANTGIAAGTTREHLGLALALKVPFFIVVSKVDLCAKTT
VERTVRQLERVLKQPGCHKVPMLVTSEDDAVTAAQQFAQSPNVTPIFTLSSVSGESLDLL
KVFLNILPPLTNSKEQEELMQQLTEFQVDEIYTVPEVGTVVGGTLSSGICREGDQLVVGP
TDDGCFLELRVCSIQRNRSACRVLRAGQAATLALGDFDRALLRKGMVMVSPEMNPTICSV
FEAEIVLLFHATTFRRGFQVTVHVGNVRQTAVVEKIHAKDKLRTGEKAVVRFRFLKHPEY
LKVGAKLLFREGVTKGIGHVTDVQAIAAGEAQANMAF
Download sequence
Identical sequences ENSSSCP00000017322 ENSSSCP00000017322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]