SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017420 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017420
Domain Number 1 Region: 8-116
Classification Level Classification E-value
Superfamily Histone-fold 3.69e-52
Family Nucleosome core histones 0.0000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017420   Gene: ENSSSCG00000016440   Transcript: ENSSSCT00000017901
Sequence length 116
Comment pep:novel chromosome:Sscrofa10.2:18:6383274:6385720:1 gene:ENSSSCG00000016440 transcript:ENSSSCT00000017901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQQQGGGRRGRSSGEKKSKKRNRRKETYSMYIYKVLKQVHPDIGISSKAMSIMNSFVNDV
FERLAGEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Download sequence
Identical sequences ENSSSCP00000017420 ENSSSCP00000017420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]