SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017443 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017443
Domain Number 1 Region: 408-469
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.35e-16
Family LIM domain 0.0025
Further Details:      
 
Domain Number 2 Region: 466-536
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000714
Family LIM domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000017443
Domain Number - Region: 378-411
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0058
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017443   Gene: ENSSSCG00000016461   Transcript: ENSSSCT00000017924
Sequence length 568
Comment pep:known chromosome:Sscrofa10.2:18:7099521:7110835:-1 gene:ENSSSCG00000016461 transcript:ENSSSCT00000017924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPRPPRAISVSAPVFYAPQKKFGPVVAPKPKVNPFRPGDGEPPAAAGAQRAQMGRVGE
IPPPPPEDFPLPPPPVLGEADEAEGALGGAFPPPPPPIEEPFPPAPLEEEIFPSPPPPLV
EEGGPEVPIQLPPQPRDKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVSTPFI
SKSNTKPAPGGTAPLPPWKSASSSQPLSQAQPQSQTHFHVQPQPQAKPQVQLHVQPQAQP
QPVPSANTQPRGPPAPSPAPKFSPVTPKFTPVASKFSPGAPGGPGSQPSRKSGPPEAPST
GTGSAQPPSFTYAQQREKPQVQEKQHPVPPPAPNQNQVRSSGAPGPLTLKEVEELEQLTQ
QLMQDMEHPQRQNVAVNEFCGRCRQPLARAQPAVRALGQLFHITCFTCHQCEQQLQGQQF
YSLEGAPYCEGCYTDTLEKCNTCGQPITDRMLRATGKAYHPQCFTCVVCACPLEGTSFIV
DQANRPHCVPDYHKQYAPRCSVCAEPIMPEPGREETVRVVALDKNFHMKCYKCEDCGKPL
SIEADDNGCFPLDGHVLCRKCHTTRAQT
Download sequence
Identical sequences F1SRV9
ENSSSCP00000017443 ENSSSCP00000017443 XP_003134640.2.46622 XP_005657776.1.46622 9823.ENSSSCP00000017443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]