SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017446 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017446
Domain Number 1 Region: 176-450
Classification Level Classification E-value
Superfamily Caspase-like 9.57e-82
Family Caspase catalytic domain 0.00000000036
Further Details:      
 
Domain Number 2 Region: 32-127
Classification Level Classification E-value
Superfamily DEATH domain 1.27e-21
Family Caspase recruitment domain, CARD 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017446   Gene: ENSSSCG00000016464   Transcript: ENSSSCT00000017927
Sequence length 453
Comment pep:known_by_projection chromosome:Sscrofa10.2:18:7187327:7206997:-1 gene:ENSSSCG00000016464 transcript:ENSSSCT00000017927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSAASGPALQQKGLMAADRGRRMLGVCGMHPDHQEALKKNRVVLAKQLLLSELLEHL
LEKDIITLEMREHIQAKVGSFSQNVELLNLLPKRGPQAFDAFCVALRETKQDHLEELLLE
TLSGLQHAHPPLSCDYNLSLPFPVRESCPPHKQPRLSADVGERSLDDGDGPPCLQVKPCT
PEFYQTHYQLAYRLQSRPRGLALVLSNVHFTGEKDLEFRSGGDVDHSTLVALFKLLGYQV
HVLLDQTAQEMQEKLQDFAQLPTHRVTDSCIVALLSHGVEGGVYGVDGKLLQQLQEVFQL
FDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHARSPECEESDAGKEELLKMRLP
TRSDMICGYACLRGTAAMRNTKRGSWYIEALTQVFSERACDMHVADMLVRVNALIKEREG
YAPGTEFHRCKEMSEYCSTLCRRLYLFPGQPPA
Download sequence
Identical sequences ENSSSCP00000017446 ENSSSCP00000017446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]