SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017588 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017588
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily PH domain-like 8.5e-40
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000765
Further Details:      
 
Domain Number 2 Region: 207-303
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 9.94e-35
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000627
Further Details:      
 
Domain Number 3 Region: 382-493
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.27e-25
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017588   Gene: ENSSSCG00000016604   Transcript: ENSSSCT00000018077
Sequence length 505
Comment pep:known_by_projection chromosome:Sscrofa10.2:18:25318731:25383925:1 gene:ENSSSCG00000016604 transcript:ENSSSCT00000018077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGPQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKK
CSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALN
FANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVN
NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCG
ISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPP
PPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVGVPPPPPNRMYPPPPPALPSSAPSGPPP
PPPPLSVAGSAAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTPAGSKAALLDQIREGAQLK
KVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSK
AIHSSDEDEDEDDEEDFEDDDEWED
Download sequence
Identical sequences A0A287ATX4
ENSSSCP00000017588 XP_003134773.1.46622 9823.ENSSSCP00000017588 ENSSSCP00000017588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]