SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017624 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017624
Domain Number 1 Region: 266-330
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000852
Family LIM domain 0.058
Further Details:      
 
Domain Number 2 Region: 326-392
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000235
Family LIM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017624   Gene: ENSSSCG00000016636   Transcript: ENSSSCT00000018114
Sequence length 419
Comment pep:known_by_projection chromosome:Sscrofa10.2:18:31991911:32014016:-1 gene:ENSSSCG00000016636 transcript:ENSSSCT00000018114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMAKVTKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRK
VGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNISINTVTYEWAPPVQNQAL
ARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPKEVKEMEQFVKKY
KSEALGVGDVKLPREMNAQGPNRMCIPGGDRSTTSAVGAMEDKSAEHKTTQYSCYCCKLS
MKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNDKLYCGRHYCDSEKPRCA
GCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEIYVMVNDKPVCKPCYVKNHAVVCQ
GCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKMMS
Download sequence
Identical sequences ENSSSCP00000017624 ENSSSCP00000017624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]