SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017681 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017681
Domain Number 1 Region: 109-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000715
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000017681
Domain Number - Region: 146-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00672
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 53-108
Classification Level Classification E-value
Superfamily An insect antifreeze protein 0.0732
Family An insect antifreeze protein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017681   Gene: ENSSSCG00000016691   Transcript: ENSSSCT00000018172
Sequence length 181
Comment pep:known_by_projection chromosome:Sscrofa10.2:18:49277462:49327730:1 gene:ENSSSCG00000016691 transcript:ENSSSCT00000018172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSF
RSSTPTGSEYDEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKK
RYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQ
Q
Download sequence
Identical sequences G1PM31
9615.ENSCAFP00000004462 9823.ENSSSCP00000017681 ENSSSCP00000017681 ENSMLUP00000011942 ENSMLUP00000011942 ENSSSCP00000017681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]