SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017815 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017815
Domain Number 1 Region: 219-501
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.79e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000126
Further Details:      
 
Domain Number 2 Region: 42-218
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.32e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000869
Further Details:      
 
Domain Number 3 Region: 503-609
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 5.29e-28
Family Anticodon-binding domain of Class II aaRS 0.0015
Further Details:      
 
Domain Number 4 Region: 6-40
Classification Level Classification E-value
Superfamily TGS-like 0.00000654
Family TGS domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017815   Gene: ENSSSCG00000016817   Transcript: ENSSSCT00000018310
Sequence length 620
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:20336754:20350618:1 gene:ENSSSCG00000016817 transcript:ENSSSCT00000018310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVSFLSQGLADNTVVAKVNKVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGE
AMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEIKK
ETLLEMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSST
YWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSC
FFLPKGAYIYNTLIDFIRSEYRKRGFQEVVTPNIYNSRLWVTSGHWQHYSDNMFSFEVEK
ELFALKPMNCPGHCLMFDHRPRSWRELPLRIADFGVLHRNELSGALTGLTRVRRFQQDDA
HIFCAMEQIEDEIKGCLDFLRTVYSIFGFSFKLNLSTRPEKFLGDIEVWNQAEKQLENSL
NEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDXQLPIRFNLTFVSPDGDDK
KRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVQQQFHD
AKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKSSGTVNIRTRDNKVHGERTISE
TVGRLEQLRQSRSKQAEEEF
Download sequence
Identical sequences ENSSSCP00000017815 ENSSSCP00000017815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]