SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017921 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017921
Domain Number 1 Region: 8-245
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 3.66e-29
Family Type 2 phosphatidic acid phosphatase, PAP2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017921   Gene: ENSSSCG00000016912   Transcript: ENSSSCT00000018418
Sequence length 285
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:36712738:36818550:-1 gene:ENSSSCG00000016912 transcript:ENSSSCT00000018418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGLFCNDESIKYPYKEDTIPYPLLG
GIIIPFSIIVMIVGETLSVYFNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAK
YSIGRLRPHFLDVCDPDWSKINCSDGYIENYICRGNAQKVKEGRLSFYSGHSSFSMYCML
FVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAI
VVAVYVSDFFKERNSPFKERKEEDSHTTLHETPTTGNHYRNSHQP
Download sequence
Identical sequences A0A286ZIK9
ENSSSCP00000017921 XP_003133999.3.46622 9823.ENSSSCP00000017921 ENSSSCP00000017921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]