SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018180 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018180
Domain Number 1 Region: 470-573
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018180   Gene: ENSSSCG00000021040   Transcript: ENSSSCT00000018681
Sequence length 599
Comment pep:known chromosome:Sscrofa10.2:12:2328228:2349430:1 gene:ENSSSCG00000021040 transcript:ENSSSCT00000018681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPLKHPKGFAPMSCCWSTETMQKRLPFLAWLPNYTWYALKMDFIAGISVGLTVIPQAL
AYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFREPAYAVLLA
FLSGCIQLGMGFLRLGFLLDFISCPVIKGFTSAAAITIGFGQIKNLLGLQHIPRQFFLQV
YQTFHNIGETRVGDAVLGLVCMVLLLVLKLMRDHVPPVHPEMPPGVRLSHGLVWTATTAR
NALVVSFAALVAYSFEVTGYQPFVLTGKTPEGLPDPSIPPFSVATTNGTISFTQMVQGMG
AGLAVVPLMGLLESIAVAKSFASQNNYRVDANQELLAIGLTNILGSLFSSYPVTGSFGRT
AVNAQSGVCTPAGGLMTGALVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFDTKILGTL
WRVKRLDLLPLCVTFLLCFWEVQYGILAGTLVSVVILLHSVARPKIQVSEGPVLILQPSS
GLHFPAIETLREMVLSRALETSPPRSVALDCTHIFSIDYTVVLGLGELLEDFHKRGATLA
LIGLQVPVLRVLLSADLKGVLYFSTLEEAEKYLKQEPGTQPYNISEDSVPEHKVALLKA
Download sequence
Identical sequences M3V826
ENSSSCP00000018175 ENSSSCP00000018180 ENSSSCP00000018175 ENSSSCP00000018180 9823.ENSSSCP00000018175 9823.ENSSSCP00000018180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]