SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018321 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018321
Domain Number 1 Region: 68-107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000103
Family LIM domain 0.00074
Further Details:      
 
Domain Number 2 Region: 34-66
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000571
Family LIM domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018321   Gene: ENSSSCG00000017291   Transcript: ENSSSCT00000018823
Sequence length 128
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:15212869:15214392:1 gene:ENSSSCG00000017291 transcript:ENSSSCT00000018823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQAAGAAQATPSHETKGGGGSSTVQRSKSFSLRAQVKETCTACQKTVYPMERLVADKLI
FHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWAHKE
VDSGTKTA
Download sequence
Identical sequences A0A287B2K6
ENSSSCP00000018321 9823.ENSSSCP00000018321 NP_001231640.1.46622 XP_020921757.1.46622 XP_020921758.1.46622 ENSSSCP00000018321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]