SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018354 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018354
Domain Number 1 Region: 22-146
Classification Level Classification E-value
Superfamily Lysozyme-like 2.59e-44
Family C-type lysozyme 0.0000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018354   Gene: ENSSSCG00000017321   Transcript: ENSSSCT00000018857
Sequence length 148
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:17920807:17924680:1 gene:ENSSSCG00000017321 transcript:ENSSSCT00000018857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRPLLISLVSCLVAVSQASLINRCDLAKVLHQEDLDGFEGYSLSDWLCLAFVESEFNIT
KVNENTDGSFDYGIFQINSHYWCNDYRSHTENICQVECEELLSPNLLSIINCAKKIVSGA
GGMKNWVKWRLHCAGRPLSYWMTGCHLG
Download sequence
Identical sequences F1RRQ9
ENSSSCP00000018354 ENSSSCP00000018354 XP_020921979.1.46622 9823.ENSSSCP00000018354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]