SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018521 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018521
Domain Number 1 Region: 137-164,196-415
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-75
Family Nuclear receptor ligand-binding domain 0.00000000264
Further Details:      
 
Domain Number 2 Region: 85-168
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.83e-31
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018521   Gene: ENSSSCG00000017475   Transcript: ENSSSCT00000019026
Sequence length 462
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:22357386:22381315:-1 gene:ENSSSCG00000017475 transcript:ENSSSCT00000019026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHPLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEAPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQAGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Download sequence
Identical sequences F1RXC9
XP_003131522.1.46622 XP_020922680.1.46622 9823.ENSSSCP00000018521 ENSSSCP00000018521 ENSSSCP00000018521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]