SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018527 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018527
Domain Number 1 Region: 52-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.24e-27
Family Nuclear receptor 0.00000882
Further Details:      
 
Domain Number 2 Region: 147-324
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.73e-21
Family Nuclear receptor ligand-binding domain 0.000000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018527   Gene: ENSSSCG00000017480   Transcript: ENSSSCT00000019032
Sequence length 505
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:22489120:22501282:1 gene:ENSSSCG00000017480 transcript:ENSSSCT00000019032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHVATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
EVTQSQLVLMIRCCCATMSSIMAQRNDPARDPRPLRRELPPLRHQVPKGRAADQSCPCFH
LSAGLSGLWLEPPPTLLVRSALLVCTWKAMLCCPSGIPTSASPFPVSAMHMVEKRPSMPP
QYWPGALVKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQLG
EAGSLRGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEAGSLTSSDEDPEVCE
DAAQATQPLPEAPPRADGEGGGGGS
Download sequence
Identical sequences ENSSSCP00000018527 ENSSSCP00000018527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]