SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018690 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018690
Domain Number 1 Region: 132-329,360-709
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.5e-162
Family Myeloperoxidase-like 0.0000000000554
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000018690
Domain Number - Region: 28-85
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.051
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018690   Gene: ENSSSCG00000017636   Transcript: ENSSSCT00000019198
Sequence length 713
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:36259813:36286801:-1 gene:ENSSSCG00000017636 transcript:ENSSSCT00000019198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVFLPLPVLLASLALFQAAASATKAQTPSTAAISDAVNQAKVQVNKAFLDSRTRLKTAM
STEAPTTRQLSEYLKHAKGRTRTAIRNGQVWEESLKRLRQKATQTNVTDPSLDLTALSWE
VGCDAPVPMVKCDENSPYRTITGDCNNRRNPALGAANRALARWLPAEYEDGLSLPFGWTP
GKTRNGFPVPLAREVSNKIAGYLNEEDVLDQNRSLLFMQWGQVVDHDLDFAPDTELGSSE
YSKAQCDEYCIQGDNCFPIMPFPARQPRLLGQSLFFFPSLTHLFICSRQNWDALGRTAYG
AMPSWSSLPLPLGSLLSSKIHSPRTNALPTQMQQKAQSSLILCPHKYPLRPSICEFNRLS
FFSVTCGLSGDSRASEQILLATSHTLLLREHNRLARELKRLNPQWDGEKLYQEARKILGA
FIQIITFRDYLPIVLGDEMEKWIPPYQGYNQSVDPRISNVFTFAFRFGHLEVPATMSRLD
ENYQPWGPEAELPLHTLFFNTWRIVKDGGIDPLVRGLLAKKSKLMNQDKMMTGELRNKLF
QPTHKIHGFDLAAINIQRGRDHGMPGYNSWRGFCDLSQPQTLEELRAVLKNEKLAKKLLD
LYGTPDNIDIWIGGTAEPLVERGRVGPLLACLLGRQFQQIRDGDRFWWENPGVFTEKQRN
ALQKMSFSRLVCDNTHITKVPLHPFQANSYPHGFVDCSAIDKLDLSPWASVED
Download sequence
Identical sequences ENSSSCP00000018690 ENSSSCP00000018690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]