SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018852 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018852
Domain Number 1 Region: 1048-1177
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000386
Family GAF domain 0.02
Further Details:      
 
Domain Number 2 Region: 289-361,888-934
Classification Level Classification E-value
Superfamily EF-hand 0.0000128
Family Calbindin D9K 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018852   Gene: ENSSSCG00000017794   Transcript: ENSSSCT00000019366
Sequence length 1521
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:48294195:48455617:-1 gene:ENSSSCG00000017794 transcript:ENSSSCT00000019366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNESASQEEPKPTEENGKEDKERKQEETETKDPIKSSKSTLDISASGTCSNVAEAAANKT
KSQELNLEGQPKMSTRSIKDSKPGVSKNTVFRKPAKVIFNLDQTTQDSKLEQPWKKNLFE
RVQARAQAMQQKIIDKENLKKELEKKTEEKLPKDNLAKEWFNTETMTLNTRAYLLDKLLP
TLVPGMEKMLMQVEKKKLLTEADIPTKFDPINHLGEYLMRNNPNYIKDVEISGYQRVMRD
VTEDLKMYVPNTIYNRVSKMKENIKQKREQRESINEVKVKVANTRKHALLEQFNEWILDP
KGMIPMIVIQNALHEFFQNPDFQLELETCCQQLDIANSMEPRLNKMEFIELISSYITDFK
SEMFEGLLKHLCHCADEFRAVIKADMRRQMFAELFLYCDHGKVGFLDRQRTLALLETFYD
QSSKVLRGVLRNPRQWPFVEFGEQDLPEFWGDMDNQKHIYEDFDKVLLKMNTLLSEKQGS
KTKSKLLANPEDQYKHDEHRKSTRPQSPPEQQRGTTEEQEPNRISTKELEQDRESTGEQE
LYEESVAERGGYTGPTTEQGSSRELIIEQRPYKQGPHRQSSAEQGPHRGSTAEEGSHGES
VLEPRRGSVLEEGARRESVVEQGPRRGSILEEEARRESVVEQGPRRGSILEEAPRRESGV
EQGPQTAEQPPPTETIPEKQQDEDLTSQSRKGSILRESKKSREVISSEYSEIPPQEERTL
EEIYEEQLFISSELQEKISASHRKSHLSETAKKEIQKDKSCERKSQKIEGKSWSGELLTC
NWNTKYARCEDEEQANSIYGNSRFTDLHSIIRNIQSYTELKGRSAFNGVSFNLLQFVQLL
ETFVGEDSPLSVSEALTSFFKRSFVETKEEKMSSLEEAKQNASQVRRRLLLKALFQKWDS
DGSGFLDLKEIDELLYTYKEGMEKESMKKAKLHIQFPKPHPDHEVRLSSKQFQKYIELVV
SELRGNEDHILENVVEFLMSALERSHVESLRNCARQKWLHQIQRAAETSGVSLDPVYTET
FKALTQDSKAHGNKKISAHISLLEENLLLPDRGNVLLRNVACTLDDAPFVLNRVLYRDMK
GISFTVVDEGKPIHVPQVQHHGNIYFWNYSRKKNDQNGSFLALPLQDASMRIFGVLAVDT
LRDPQKINIFLPHEIRFYQGVANVFSAAYHYVRSREHILHIVITGIGWLYNIITSSITAI
TTYFIEPGLEQDSDYVLRNMMVTGHLGLTEIHKNPPTIFRKTCIFRDFLYKCTDSSEVVL
ASVCGENHIAVPLRERTGEALGVLDVNIGRSKMLFYREFKDLQKMIKVIQVACNEILGEL
SGEIKKNYILEIENVGEVQRAGILFFRVMLQELQGCLRLLTSVDFVSLLLYDYNPLAEPK
SPPDSKSQELEANIKLVQDILKAIILFFHPELELSSDLRNWDKCKLYINRYLVENICDFD
PTARNLKVNLKLIDDYIGGHSRTEVWEFGNIAIEYLYHWAYICLALMKLNKKINSAISPP
LPSKTDSYMYAKMPGESLLGK
Download sequence
Identical sequences ENSSSCP00000018852 ENSSSCP00000018852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]