SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019152 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019152
Domain Number 1 Region: 327-563
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.9e-64
Family Nuclear receptor ligand-binding domain 0.000000321
Further Details:      
 
Domain Number 2 Region: 84-168
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.59e-30
Family Nuclear receptor 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019152   Gene: ENSSSCG00000026427   Transcript: ENSSSCT00000029985
Sequence length 574
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:106398577:106422061:1 gene:ENSSSCG00000026427 transcript:ENSSSCT00000029985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGTWPGAAADRDSGGPWPHGWSNSLSHGHKLGRKLGGARQDQRGGGRREGPDGATPFPP
SPQMPFCWEELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNVA
YSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQ
RQQQQREQAAKSPPAGAQGADPLACPLGLPDGQLPLGSSPDLPEASACPPGLLRAPSCGP
SYSNSLVKAGLNGASYHLEYSPERGKAEGRENFYGTGSQLAPDRCGLRFEDPRHPGLGEP
GRGPDSYCSPSFRSTPEAPYASLTEIEHLVQNVCKSYRDTCQLRLEDLLRQRSNIFSREE
VAGYQRKSMWEMWERCAHRLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVR
MCRAYNADNHTVFFEGKYGGMELFRALGCSELISSIFDFSRSLSALRFSEDEIALYTALV
LINANRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQGILAKLPPKGKLRSLCSQHVEKLQ
TFQHLHPIVVQVAFPPLYKELFSTEIESSDGLSE
Download sequence
Identical sequences ENSSSCP00000019152 ENSSSCP00000019152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]