SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019378 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019378
Domain Number 1 Region: 1-51
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.3e-17
Family Double-stranded RNA-binding domain (dsRBD) 0.00012
Further Details:      
 
Domain Number 2 Region: 125-229
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000157
Family RecA protein-like (ATPase-domain) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019378   Gene: ENSSSCG00000024375   Transcript: ENSSSCT00000028501
Sequence length 245
Comment pep:known chromosome:Sscrofa10.2:9:136360731:136364508:1 gene:ENSSSCG00000024375 transcript:ENSSSCT00000028501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVIEAYSGLTKKKEGETVEPY
RVNISPELEHQLQNIVQELDLDIVPPPEDPSVPVTLNLGKLAHFEPSQRQNQIGVVPWSP
PQSNWNPWTSSNIDEGPLAFATPEQISVEIKNELMYQLEQDRDLQAILQERELLPVKKFE
SEILEAISQNPVVIVRGATGCGKTTQVPQFILDDFIQNDRAAECNIVVTQVSSKPAYDVP
GVDSF
Download sequence
Identical sequences ENSSSCP00000019378 ENSSSCP00000019378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]