SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019769 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019769
Domain Number 1 Region: 1-224
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.25e-72
Family Nuclear receptor ligand-binding domain 0.00000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019769   Gene: ENSSSCG00000024896   Transcript: ENSSSCT00000030949
Sequence length 225
Comment pep:novel scaffold:Sscrofa10.2:GL895405.2:3659:6512:1 gene:ENSSSCG00000024896 transcript:ENSSSCT00000030949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFASLDLN
DQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAM
KFNALELDDSDLSLFVAAIICCGDRPGLLNVGHIERMQEGIVHVLKLHLQTNHPDDVFLF
PKLLQKLADLRQLVTEHAQLVQVIKKTEADAALHPLLQEIYRDMY
Download sequence
Identical sequences ENSSSCP00000019769 ENSSSCP00000019769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]