SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019810 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019810
Domain Number 1 Region: 124-422
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-90
Family Nuclear receptor ligand-binding domain 0.0000000013
Further Details:      
 
Domain Number 2 Region: 21-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-28
Family Nuclear receptor 0.00000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019810   Gene: ENSSSCG00000020864   Transcript: ENSSSCT00000032274
Sequence length 427
Comment pep:known chromosome:Sscrofa10.2:5:81277766:81339276:-1 gene:ENSSSCG00000020864 transcript:ENSSSCT00000032274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
RPKLSEEQQRIIAILLDAHHKTYDPTYADFGQFRPPVRGDEEEGTLPSRSSSAHAPSFSG
SSSSSCSDQYTSSPDTMEPASFSHLDLSEEDSDDPSVTLDLSQLSMLPHLADLVSYSIQK
VIGFAKMIPGFRDLTAEDQIVLLKSSAIEVIMLRSNQSFTMDDMSWTCGSRDYKYQVSDV
AKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDPTLIEAIQDRLS
NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
VFGNEIS
Download sequence
Identical sequences A3RGC1
ENSSSCP00000019810 ENSSSCP00000019810 NP_001090883.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]