SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019875 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019875
Domain Number 1 Region: 36-124
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.69e-38
Family SCAN domain 0.0000473
Further Details:      
 
Domain Number 2 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 271-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 410-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-18
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 309-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019875   Gene: ENSSSCG00000021941   Transcript: ENSSSCT00000024849
Sequence length 469
Comment pep:novel chromosome:Sscrofa10.2:3:7262536:7265875:1 gene:ENSSSCG00000021941 transcript:ENSSSCT00000024849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTKVLGMATVLGPRPPQEQGPVIVKVEEEEKGKRLEMFRQRFRQFGYHDTPGPREALSQ
LRVLCCEWLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCPESAEEAVTLLEDLER
ELDEPAQQASPPPREQSQSWETMSSGMTKESLSSPQPQALETGHQYESWGPLYIQETGEE
QGFTPELRKIQDHKSNTQHEETTDKQEGSKESHAEEFRRDTVPMIIASKCEARLERQRVN
LEKERGTKTPLQGKGSPKRRELITKPAPGERRYICAECGKAFSNSSNLTKHRRTHTGEKP
YVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQRMHTEEAPYQCKD
CGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRLHTGEKPYKCTECGKA
FNHSSNFNKHHRIHTGEKPYWCSNCGKTFCSKSNLSKHQRVHTAEREGP
Download sequence
Identical sequences F1RNP1
ENSSSCP00000019875 XP_020941845.1.46622 XP_020941846.1.46622 XP_020941847.1.46622 XP_020941848.1.46622 XP_020941849.1.46622 ENSSSCP00000019875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]