SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019962 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019962
Domain Number 1 Region: 32-86,124-246
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.62e-38
Family G proteins 0.00000498
Further Details:      
 
Domain Number 2 Region: 244-358
Classification Level Classification E-value
Superfamily Translation proteins 5.74e-36
Family Elongation factors 0.0000365
Further Details:      
 
Domain Number 3 Region: 359-456
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.35e-30
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019962   Gene: ENSSSCG00000026988   Transcript: ENSSSCT00000026981
Sequence length 470
Comment pep:novel chromosome:Sscrofa10.2:1:195352251:195355376:1 gene:ENSSSCG00000026988 transcript:ENSSSCT00000026981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQPTQDSSHLRKQDLSSLDVTKLTSLAPEVISRQATINIGTIGHVAHGKSTVVHALSGV
HTVRFKHEKERNITIKLGYANAKIYKCTNPECPAPDCYKSYGSSKEDEPPCPRPGCGHKM
ELKRHVSFVDCPGHDILMATMLNGAAVMDAALLLVAGNESCPQPQTSEHLAAVEIMRLKN
IIILQNKVELIKESQAIQRQEEIKRFVSGTAADNAPIIPISAVLNYNIDVICEYLVTQVA
VPKRDFVLPPQMIVIRSFDVNKPGELVENLQGGVAGGSILHGVLKVGDQIECRPGIISKD
SNGNIQCKPIISRIVSLFAEQNDLQFAVPGGLVGVGTAMDPTLTRADRLVGQVIGHVGKL
PDCFIEIEMSYYLLRRLLGIKAPDGDRSTKVSKLKKGEFLMINIGSTSVGGRVSGIKPDM
AKFELTGPVCTRVGDKVALSRRVDKHWRLIGWGQINKGKALTLQKSVDDV
Download sequence
Identical sequences ENSSSCP00000019962 ENSSSCP00000019962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]