SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020075 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020075
Domain Number 1 Region: 30-296
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.96e-55
Family Rhodopsin-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020075   Gene: ENSSSCG00000027908   Transcript: ENSSSCT00000023037
Sequence length 297
Comment pep:known chromosome:Sscrofa10.2:6:89575890:89602023:1 gene:ENSSSCG00000027908 transcript:ENSSSCT00000023037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHITDLYESVNSTMSNKSDCPPVVLPEEVFFTISVIGVLENLIVLLAVIKNKNLQSPMY
FFICSLAISDMLGSLYKILENILIIFRNMGYLEPRGGFESTADDVVDSLFILSLLGSICS
LSAIAADRYITIFHALQYQRLVTPRRAAVVLLIIWACCIGSGITIVTFSHHVPAVIAFTA
LFPLMLVFILCLYGHMFLLARSHARRVSTLPRANMKGAITLTVLLGVFIFCWAPFVLHIL
LMTFCPADPYCACYLALFQVNAVLIMCNAIIDPFIYAFRSPELRDAFKKMIICKRYP
Download sequence
Identical sequences Q8HYN8
ENSSSCP00000020075 XP_003482080.1.46622 ENSSSCP00000020075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]