SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020156 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020156
Domain Number 1 Region: 85-114
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000303
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 49-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000695
Family LIM domain 0.0034
Further Details:      
 
Domain Number 3 Region: 21-49
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000101
Family LIM domain 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000020156
Domain Number - Region: 115-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00104
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020156   Gene: ENSSSCG00000023057   Transcript: ENSSSCT00000022371
Sequence length 156
Comment pep:known chromosome:Sscrofa10.2:9:1248307:1282660:-1 gene:ENSSSCG00000023057 transcript:ENSSSCT00000022371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGE
VGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCN
QRFCVGDKFFLKNNMILCQLDYEEGQLTGAFEPQAQ
Download sequence
Identical sequences A9ED79
ENSSSCP00000020156 NP_001106526.1.46622 XP_020957596.1.46622 ENSSSCP00000020156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]