SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020158 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020158
Domain Number 1 Region: 889-940
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000171
Family Erythroid transcription factor GATA-1 0.0024
Further Details:      
 
Domain Number 2 Region: 1217-1264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000402
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000020158
Domain Number - Region: 690-732
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0769
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020158   Gene: ENSSSCG00000027648   Transcript: ENSSSCT00000025325
Sequence length 1282
Comment pep:novel scaffold:Sscrofa10.2:GL893325.2:63796:244245:1 gene:ENSSSCG00000027648 transcript:ENSSSCT00000025325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRKKNPPLRNIASEGEGQTLEPIGTESKVSGKNKEFSADQMSENTDQSDAAELNNKEEQ
SLHVQDPSSSSKKDLKSSVLSEKAGFNYESPGKGGSLPSYPHDEVTDRNMLAFLSPAAGG
VCEPLKSPQRAEADDPQDMACTPAGDSLETKEDPKMSPKATEETGQAQSGQANCQGSSPV
SVASKNPQVPSDGGVRLNKSKTDLLVNDNPDPAPLSPELQDFKCNICGYGYYGNDPTDLI
KHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQKVNRSVLSGVLQDINSSRPV
LLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNFTYMGNSSTELEQHFLQTHPN
KIKTSLPSSEGAKPSEKNSNKSIPALRSSDSGDLGKWQDKITVKAGDDTPVGYSVPIKPL
DSSRQNGTEATSYYWCKFCSFSCESSSSLKLLEHYSKQHGGTQSGSLNPELNDKLSRGSV
INQNDLAKSAEGEPMAKAEKGSSGAKKKDFASKGAEDNMVTSYNCQFCDFRYSKSHGPDV
IVVGPLLRHYQQLHNIHKCTIKHCPFCPRGLCSPEKHLGEITYPFACRKSNCSHCALLLL
HLSPGAAGSSRVKHQCHQCSFSTPDVDVLLFHYESAHDAQASDVKQEGNHLQGSDGQQAV
KESKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFTAAETQSLLEHFNTVHCQEQD
ITTANGEEDSHAVSTIKEEPKMDLKVYSLLNPDSKMGEPVSESVVKREKLEDKDGLKEKA
WAESSSDDLRSVTWRGADILRGSPSYTQASLGLLTPVSGPQEPTKTLRDSPSVEAKHLRD
PVFNSWIKTKADEQTQEAQSEKEGTLSPVQYPTSGMNRTRTESQNLVQRRRGSGVFCANC
LTTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRRRTRKRLNPEALQ
AEQLNKQQRGGSEEQVNGSPLERRSEDHLTEGHQREIPLPSLSKYEAQGSLTKSHSAQQP
VLVSQTLDIHKRMQPLHIQIKSPQESTGDPGNSSSVSEGKGSSERGSPIEKYMRPAKHPN
YSPPGSPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHYLSHVPGLPNPCQ
NYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPTANGASKEKTKAPSNVKNEGPLNV
VKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFT
THIQRGLHRNNAWGENSGKSDR
Download sequence
Identical sequences ENSSSCP00000023029 ENSSSCP00000020158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]