SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020271 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020271
Domain Number 1 Region: 5-94
Classification Level Classification E-value
Superfamily DEATH domain 3.01e-16
Family Caspase recruitment domain, CARD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020271   Gene: ENSSSCG00000022457   Transcript: ENSSSCT00000031848
Sequence length 202
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:25074671:25083203:-1 gene:ENSSSCG00000022457 transcript:ENSSSCT00000031848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRR
LLLLVQSKGEAACRELLNCAQRTVHAPDPAWDWQHVGTGYRERSYDPPCPGHWSPEPAGS
GIACPWLPRASDCDETQSPEDSEAAQSGTPEEPEPQLEAEASEEAEPKLEPQMDPEPEAE
PEPDPELEPEPDFEEGDESEDS
Download sequence
Identical sequences XP_003126986.1.46622 XP_013853687.1.46622 ENSSSCP00000020271 ENSSSCP00000020271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]