SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020288 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020288
Domain Number 1 Region: 76-112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0039
Further Details:      
 
Domain Number 2 Region: 162-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000017
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 3 Region: 127-155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000877
Family LDL receptor-like module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020288   Gene: ENSSSCG00000027641   Transcript: ENSSSCT00000024167
Sequence length 205
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:145893272:145902399:-1 gene:ENSSSCG00000027641 transcript:ENSSSCT00000024167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKIFPQGEGNAAAGPKALSGGEESVGIPPCCSRQGACLSAFLLLLLATLGALIALVAIL
GPPPRTPGAQACVTPLNRTGFLCHNRRSCIPASRVCDGVPTCAHGEDEEEALCRDVPQSL
PSFLVAHCGDPAFWIYSDQKCDGFNNCGDCSDELSPVTTCPPCGPEWWRCPSTVFKYCTC
IPRSLCRDHVQHCSDWSDEYSCPGP
Download sequence
Identical sequences ENSSSCP00000020288 ENSSSCP00000020288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]