SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020330 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000020330
Domain Number - Region: 532-665,726-832
Classification Level Classification E-value
Superfamily ARM repeat 0.0108
Family PBS lyase HEAT-like repeat 0.032
Further Details:      
 
Domain Number - Region: 3-71
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.047
Family LIM domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020330   Gene: ENSSSCG00000023425   Transcript: ENSSSCT00000022848
Sequence length 1113
Comment pep:novel scaffold:Sscrofa10.2:GL893398.2:21274:44066:-1 gene:ENSSSCG00000023425 transcript:ENSSSCT00000022848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEICRICARELCGNQRRWIFHTASKLNLQVLLSHVLGKDVSRDGKGEFACSKCAFMLDR
IYRFDTVIARIEALSIERLQKLLLEKDRLKFCIASMYRKNNDDTGPETKAGNGTVDISGL
PDVRYSALLQEDFAYSGFECWVENEDQIQELHSCHASEGPGNRPRRCRGCAALRVADSDY
EAICKVPRKVAKSISCGPSTRWSTSICTEEPALSEVGPPDLSISKVPPDGESMEEETPGS
SVESLDASVHASPPQQKDEEPERSAKELVKCDCCSEEQASQHTCNPKLELVLSMIKGLDY
KPIQSPRGSKLPIPVKSSPPGARLGHVMTDGVSSGFLNRSLKPLYKTPVTYPLEISDLQE
LWDDLCEEYLPLRVQVKDNNILDLRKIIIEPTLALPFSCVPFSKLDSLRTNGERIEISEK
KMKEKLNSTTNRKKSCYPKEQDCSISKHRQESVKKRALNQENLNDCLLAGKDFMLRNIRP
GSISLLMLKSIHPASKASQYVTFIEVGICCDYSCQDGFSKEVSFVENVLSLKKNCYKMLN
YLSNVSNHQKKKKKKKKELRKALQQLQGELQNKSQQLHTLEAEKCNAIRIQEQHIQHLNH
SLSHKEQLLQEFRELLQYRDNSDKTLDANEMLLEKLRQRIQDRDVALERAIDEKFSSLEE
KEKELRQLHLAVRERDHDLERLRGVLSSNEATIQSMESLLRAKGLEVEQLSATCQNLQWL
REEMETKFSHWQKEQESIIQQLQTSLHDRNKEVEDLSATLLCKLGPGQSEIAEELCQRLQ
RKERMLQDLLSDRNKQAVEYEMEIQGLLQSMSTREQESQAAAEKMVQALMERNSELQALR
QYLGGKDFTMSQALISNRPAEVTSISPHLGEQTDQGLMHIPSRDDSTSLTAKGDASIPRS
SGGDLDTVTGLEKELSSAKEELELMAKKERESRMELSALQSMMAVQEEELQVQAADLESL
TRNIQIKEDLIKDLQMQLVDPEDIPAMERLTQEVLLLREKVASVESQGQETSGNRRQQLL
LMLEGLVDERSRLNEALQAERQLYSSLVKFHAHPESSERDRTLQVELEGAQVLRSRLEEV
LGRSLERLSRLETLAAIGGGELESVQIRHKHAF
Download sequence
Identical sequences ENSSSCP00000020330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]