SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020334 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020334
Domain Number 1 Region: 72-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000485
Family EGF-type module 0.015
Further Details:      
 
Domain Number 2 Region: 157-218
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000209
Family TSP type-3 repeat 0.00088
Further Details:      
 
Domain Number 3 Region: 18-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000209
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000020334
Domain Number - Region: 122-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00257
Family EGF-type module 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020334   Gene: ENSSSCG00000024986   Transcript: ENSSSCT00000029318
Sequence length 227
Comment pep:known chromosome:Sscrofa10.2:2:90762307:90775311:-1 gene:ENSSSCG00000024986 transcript:ENSSSCT00000029318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CTDTRDGFQCGPCPEGYTGNGVTCSDVDECRYHPCYPGVRCVNLAPGFRCDACPVGFTGP
TVQGVGINFAKTNKQVCTDIDECRNGACVLNSICVNTLGSYRCGPCKPGYIGDQMRGCKM
ERNCRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSAR
NCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQVGSCFAG
Download sequence
Identical sequences ENSSSCP00000020334 ENSSSCP00000020334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]