SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020364 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020364
Domain Number 1 Region: 621-919
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-56
Family G proteins 0.00000896
Further Details:      
 
Domain Number 2 Region: 1087-1217
Classification Level Classification E-value
Superfamily Translation proteins 1.48e-33
Family Elongation factors 0.0011
Further Details:      
 
Domain Number 3 Region: 963-1083
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 1.57e-32
Family Initiation factor IF2/eIF5b, domain 3 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020364   Gene: ENSSSCG00000008180   Transcript: ENSSSCT00000022947
Sequence length 1219
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:57496094:57541127:-1 gene:ENSSSCG00000008180 transcript:ENSSSCT00000022947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGWSQKQNQLSAKDDIDLDALAAEIEGAGAAKEQEPQKSKGKKKKEKKRQDFDEDDILKE
LEELSWEAQGIKADRETAAVKPTENNEDESTSKQDKKKKGQKGKKQSFEDNDSEELEDKD
SKSKKTAKPKVEMYSASDDDDDFNKVSKKAKGKAQKSNKKWDGSEEDEADSKRIKERARV
HSSGESGDESDEFLPSRKGQKKNQKNKPGPNVESGNEDDDSSFKIKTVAQKKAEKKERER
KKRDEEKAKLRKLKEKEELESGKKDQSKPKDSQRKTEEEAVKSKVILDSGAAPAPEEKGE
TPAAAEDDNEGDKKKKDKKKKKGEKEEKEKEKKKGPSKATVKAMQEALAKLKEEEERQKR
EEEERIKRLEELEAKRKEEESPKDTLHVYQELCWKLGLFKXKKEGKLLTKSQREARARAE
ATLKLLQAQGVEVPSKDSLPKKRPIYEDKKKKKTPQQLENKAVSEPVDLSASVEVVEQGE
AEKEETPPPVEPEEEEETEDAGLDDWEAMASDEETETEGNTVHIEVKENPEEEEEEEEEE
EEEEESEEEEEEEGESEGSEADEEDEKVSDEKDAGKTLDKKPSKEVSSESEYDSDDDRTK
EERAYDKAKRRIEKRRLEHSKNVNTEKLRAPVICVLGHVDTGKTKILDKLRHTHVQDGEA
GGITQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLCD
IAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDTDVAVTLKKQKK
NTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVEL
TQTMLSKRLAHCEELRAQVMEVKALPGMGTTIDVILINGRLKEGDTIIVPGVEGPIVTQI
RGLLLPPPMKELRVKNQYEKHKEVEAAQGVKILGKDLEKTLAGLPLLVAYKEDEIPVLKD
ELIHELKQTLNAIKLEEKGVYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMKA
SVMLEHDPQYAVILAFDVRIERDAQEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQKQ
EEFKHIAVFPCKIKILPQFIFNSRDPIVMGVTVEAGQVKQGTPMCVPSKNFVDIGIVTSI
EVNHKQVDVAKKGQEVCVKIEPIPGESPKMYGRHFEATDILVSKISRQSIDALKDWFRDE
MQKSDWQLIVELKKVFEII
Download sequence
Identical sequences ENSSSCP00000020364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]