SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020467 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020467
Domain Number 1 Region: 538-570,651-725
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.84e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000020467
Domain Number - Region: 230-288
Classification Level Classification E-value
Superfamily LanC-like 0.085
Family LanC-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020467   Gene: ENSSSCG00000028969   Transcript: ENSSSCT00000028275
Sequence length 782
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:118120578:118178767:1 gene:ENSSSCG00000028969 transcript:ENSSSCT00000028275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGSRLEPPPLPEYSCSYVVSRPVYSELAFQQQYERRLQERKTLRESLAKRCSCSRKR
TLGVLKTLLPVLDWLPKYRIKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPVGYGLYSA
FFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSMAPDEHFIISSSNGTALNTTVIDFAA
RDAARVLIASTLTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVL
NVSTKNYNGILSIIYTLIEIFQNIGNTNLADFIAGLLTIIICMAVKELNDRFKHKIPVPI
PIEVIVTIIATAISYAVNLEKNYNAGIVKSIPRGFLPPEIPPISLFSEMLTASFSIAVVA
YAIAVSVGKVYAIKYDYTIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKT
QIAGIISAAVVMIAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVCDVPRLWRQNKTDAV
IWVFTCIASIILGLDLGLLAGLMFGFLTVVVRVQFPSWNSLGSIPNTDIYRSTKDYKNIE
EPEGVKILRFSSPIFYGNVDGLKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKKGQLRAT
KNGIISDAGSSNNAFEPDEDIEDPEELDIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVL
DCGAVSFLDVVGVRSLRMIVKEFQRIDVHVYFASLQDHVIEKLEQCGFFNDSIRKDIFFL
TVHDAILHLRSQVKSQEVQDSILETITLIQDCKDPLELMEAELIEEELDVQDEKRSTKRM
AS
Download sequence
Identical sequences ENSSSCP00000020467 ENSSSCP00000020467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]