SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020515 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020515
Domain Number 1 Region: 30-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.23e-31
Family Ribosomal protein S14 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020515   Gene: ENSSSCG00000015503   Transcript: ENSSSCT00000029797
Sequence length 128
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:128703421:128715554:1 gene:ENSSSCG00000015503 transcript:ENSSSCT00000029797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAAFVVGVLIIGFEEMVPSSASGQVRSYYVDWKMLRDVKRRKMAYEYADERLRINSLRKN
TILPKDLQEVADEEIASLPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQL
SGVQRAMW
Download sequence
Identical sequences ENSSSCP00000020515 ENSSSCP00000020515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]