SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020543 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020543
Domain Number 1 Region: 107-192
Classification Level Classification E-value
Superfamily Immunoglobulin 2.48e-19
Family C1 set domains (antibody constant domain-like) 0.0075
Further Details:      
 
Domain Number 2 Region: 7-90
Classification Level Classification E-value
Superfamily Immunoglobulin 1.77e-16
Family C1 set domains (antibody constant domain-like) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020543   Gene: ENSSSCG00000027665   Transcript: ENSSSCT00000029239
Sequence length 210
Comment pep:known chromosome:Sscrofa10.2:17:37987174:37988362:-1 gene:ENSSSCG00000027665 transcript:ENSSSCT00000029239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKPSRPVVSGPAARATPEQTVRFTCKSHGFSPRNISLKWFKNGNELPASQTSVEPEGNVS
YSISSTTEVLLAPGDVHSQVICEVAHVTLQGGPPLRGTANLSETIRVPPTLEVTQQPPTG
SQVNVTCLVKKFYPQRLQLTWLENGTVSRTETASTLMENKDGTFTRTSWLLVNSSAHREA
LLLTCQVEHDGQPAVTRNYALEAYVHQKEQ
Download sequence
Identical sequences ENSSSCP00000020543 ENSSSCP00000021099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]