SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020558 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020558
Domain Number 1 Region: 194-233
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000333
Family Erythroid transcription factor GATA-1 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020558   Gene: ENSSSCG00000025754   Transcript: ENSSSCT00000029300
Sequence length 266
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:69455652:69458919:-1 gene:ENSSSCG00000025754 transcript:ENSSSCT00000029300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEPTPDFMLRELQAPPCLHPEPPPGTPAQNAPRTPGCFRPSGRSFWSAHQDSVTALHF
LQETAEGLAQPPAWDTQAQGPCWEPKALRTPGPLPLAKDAKNMLSHSPGPPEAPPASSAQ
PQRKPRKQPNPQRGAEKVDPLFEGVTLKFQIKPDCSLQIIPSYSLACSSRSQGPMTGPAR
GPEANPGGSEALGPRRCASCRTQRTPLWRDAEDGTPLCNACGIRYKKYGTRCSSCWLVPR
KNVQPKRLCGRCGVSLGPHPVPTQEG
Download sequence
Identical sequences XP_020939444.1.46622 XP_020939445.1.46622 XP_020939446.1.46622 XP_020939447.1.46622 XP_020939448.1.46622 ENSSSCP00000020558 ENSSSCP00000020558 9823.ENSSSCP00000014514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]