SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020615 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020615
Domain Number 1 Region: 149-416
Classification Level Classification E-value
Superfamily Caspase-like 2.39e-90
Family Caspase catalytic domain 0.000000000439
Further Details:      
 
Domain Number 2 Region: 1-109
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-26
Family Caspase recruitment domain, CARD 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020615   Gene: ENSSSCG00000003460   Transcript: ENSSSCT00000025859
Sequence length 417
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:69087122:69111670:-1 gene:ENSSSCG00000003460 transcript:ENSSSCT00000025859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEADRQVLRHCRVRLVRELQVASLWDALLNRELFTPDMIEDIQRAGSGSRRDQARQLIT
DLETRGSQALPVFISCLEDTGQETLASLLRTSRQATKRDLGAIRPLDLHPVVIKPVELKP
EEPRPEAPRPVDIGSGGFSDVCGPDRAKGNADLAYVLNADPCGHCLIINNVNFCHESGLR
KRTGSNIDCERMQRRFHLLHFVVDVKCNLTAKQMVQALVELARRDHGALDCCVVVVLSHG
CQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEV
ASPSPEDRTADSNPEPDAAPFQEGPGAVDQPDAVSSLPTPSDILVSYSTFPGFVSWRDTT
SGSWYIETLDGVLEQWAHCEDLLTLLLRVSNAVSVKGIYKQIPGCFNFLRKKLFFKT
Download sequence
Identical sequences ENSSSCP00000020615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]