SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020797 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020797
Domain Number 1 Region: 205-332
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.18e-52
Family Retrovirus capsid protein, N-terminal core domain 0.00000305
Further Details:      
 
Domain Number 2 Region: 1-103
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 2.24e-42
Family MMLV matrix protein-like 0.00000751
Further Details:      
 
Domain Number 3 Region: 473-513
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000478
Family Retrovirus zinc finger-like domains 0.00074
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000020797
Domain Number - Region: 342-371
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00476
Family Retrovirus capsid protein C-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020797   Gene: ENSSSCG00000021600   Transcript: ENSSSCT00000026389
Sequence length 524
Comment pep:novel chromosome:Sscrofa10.2:8:54512171:54563745:1 gene:ENSSSCG00000021600 transcript:ENSSSCT00000026389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQTVMTPLSLTLDHWTEVKSRAHNLSVQVKKGPWQTFCVSEWPTFDVGWPSEGTFNSEI
ILAVKAIIFQTGPGSHPDQEPYILTWQDLAEDPPPWVKPWLNKPRKPGPRILALGEKNKH
SAEKVKPSPHIYPEIEEPPAWPEPQSVPPPPYPAQGAARGPSAPPGAPAVEGPAAGTRSW
RGATPERTDEIATLPLRTYGPPIPGGQLQPLQYWPFSSADLYNWKTNHPPFSEDXQRLTG
LVESLMFSHQPTWDDCQQLLQTLFTTEERERILLEARKNVPGADGRPTQLQNEIDMGFPL
TRPGWDYNTAEGRESLKIYRQALVAGLQGASRRPTNLAKVREVMQGPNEPPSVFLERLME
AFRRFTPFDPTSEAQKASVALAFIGQSALDIGKKLQRLEGLQEAELRDLVKEAEKVYYKR
ETEEEREQRKEREREEREERRNKRQEKNLTKILAAVVEGKSNRERERDFRKIRSGPRQSG
NLGNRTPLDKDQCAYCKEKGHWARDCPKKGNKGLKVLALEEDKD
Download sequence
Identical sequences ENSSSCP00000020797 ENSSSCP00000020797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]