SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020883 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020883
Domain Number 1 Region: 46-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.92e-38
Family SCAN domain 0.0000617
Further Details:      
 
Domain Number 2 Region: 643-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 475-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 587-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.89e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 531-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.78e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 381-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 685-737
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.77e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 225-271
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000144
Family KRAB domain (Kruppel-associated box) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020883   Gene: ENSSSCG00000022195   Transcript: ENSSSCT00000022569
Sequence length 754
Comment pep:novel chromosome:Sscrofa10.2:13:30515181:30527713:-1 gene:ENSSSCG00000022195 transcript:ENSSSCT00000022569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQGRGTLGLIPRGAGLQKQEGHLLVKQEPASQTWGQGCSLQKHHPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPE
SGEEAVAVVEDFQRHVSGPGQISAPAQEQEMHSEETTALGATEESPPISPLNEGSASGAH
LEPPCDPGAHHLPNRHSAQRASSVPALPQGGNFGDQAATTVLQMVRPQEPAEYEFLSVDY
TQKKWKGPALSQRALYRNIVPENCHSLASLAGENGMECSDLPPKQESSKESEASDRTSGV
LYEVIPGGPVAGDAYEEALEKLGAQPSDEEGSRLESDLLEITQEDKNKCTEDGCAEYKDL
GEHPDLSPSPVGHQGVLKGQKFYQCDECGKAFNRSSHLIGHQRIHTGEKPYECTECGKTF
RQTSQLIVHLRIHTGEKPYECSDCGKTYRHSSHLIQHQRLHSGEKPYKCNECAKAFTQSS
QLIDHQRTHTGEKPYECSECGEAFIRSKSLVRHQVLHTGEKPYKCNECGKAFCSNRNLID
HQRIHTGEKPYECNECGKAFSRSKCLNRHQSLHTGEKPYKCSECGKAFNQNSQLVDHERI
HTGEKPFECNECGKAFSLSKCLIRHQRLHTGEKPYKCKECGKSFNQNSHLIIHQRIHTGE
KPYECNECGKVFSYSSSLMVHQRTHTGEKPYKCKDCEKAFRDSSQLIVHQRVHTGEKPYE
CIECGKAFSQRSTFNHHQRTHTGEKHSGLARSIS
Download sequence
Identical sequences ENSSSCP00000020883 ENSSSCP00000020883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]